PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00024800-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8965.54 Da    PI: 10.6601
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00024800-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.3e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        kri+n++ rqvtfskRr+g++KKA ELS+LCdae a+i+fs tgkl++y+s
  WALNUT_00024800-RA  9 KRIDNTTARQVTFSKRRKGLFKKALELSTLCDAEMALIVFSATGKLFDYAS 59
                        79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.913161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-28263IPR002100Transcription factor, MADS-box
CDDcd002652.01E-34370No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MTRKKIQIKR IDNTTARQVT FSKRRKGLFK KALELSTLCD AEMALIVFSA TGKLFDYASP  60
RFLSLSHTSL LIEEHISY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-19359258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-19359258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-19359258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-19359258MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3mu6_D2e-19359258Myocyte-specific enhancer factor 2A
3mu6_C2e-19359258Myocyte-specific enhancer factor 2A
3mu6_B2e-19359258Myocyte-specific enhancer factor 2A
3mu6_A2e-19359258Myocyte-specific enhancer factor 2A
3p57_J3e-19359258Myocyte-specific enhancer factor 2A
3p57_I3e-19359258Myocyte-specific enhancer factor 2A
3p57_D3e-19359258Myocyte-specific enhancer factor 2A
3p57_C3e-19359258Myocyte-specific enhancer factor 2A
3p57_B3e-19359258Myocyte-specific enhancer factor 2A
3p57_A3e-19359258Myocyte-specific enhancer factor 2A
3kov_J3e-19359258Myocyte-specific enhancer factor 2A
3kov_I3e-19359258Myocyte-specific enhancer factor 2A
3kov_B3e-19359258Myocyte-specific enhancer factor 2A
3kov_A3e-19359258Myocyte-specific enhancer factor 2A
1tqe_S3e-19159159Myocyte-specific enhancer factor 2B
1tqe_R3e-19159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373018.18e-32hypothetical protein POPTR_0017s07205g
RefseqXP_007199240.12e-31hypothetical protein PRUPE_ppa022274mg
SwissprotQ9FUY64e-29JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLU5FIK49e-32U5FIK4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s07170.18e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.11e-28AGAMOUS-like 24